SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SSCA009249-PA from Sarcoptes scabiei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SSCA009249-PA
Domain Number 1 Region: 2-231
Classification Level Classification E-value
Superfamily PIN domain-like 2.91e-74
Family 5' to 3' exonuclease catalytic domain 0.000000261
Further Details:      
 
Domain Number 2 Region: 216-263,328-414
Classification Level Classification E-value
Superfamily 5' to 3' exonuclease, C-terminal subdomain 1.5e-29
Family 5' to 3' exonuclease, C-terminal subdomain 0.0000731
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SSCA009249-PA
Sequence length 441
Comment pep supercontig:SscaA1:JXLN01010844:6423:7808:1 gene:SSCA009249 transcript:SSCA009249-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGIHGLSRLIADITPEAIKDIDLKSLFGRRIAIDASMCLYQFLIAIRSSEYAMTNDQGET
TSHLVGMFYRTIKFLENGIKPVYVFDGKAPQLKCGELEKRTERRTEAKDKLEDAKETQNI
EEIQKLNKRLVKVTRKHSEDCKKLLQLLGIPIIQAPSEAEAQCAQLCKENLVYAVATEDM
DALTFGCPRLIRNLTSSQNEKLKEFQIERVLDGLGIDQNQFIDLSILMGCDYCDNIKGIG
GKKGLELIKKFKNIEGILKNKFGIEEFVDVEIEYNNRKIKEEIKDEIVEDQTIEAEAVDT
NRGNDSLDQDEMAEEEENDADLDGTNGRKKPVPMNWPFKGARMLFQEPLVMVNKITETDL
KMKDIDEEGIVKFLCEENGFSEDRVRKSLKRAAESKSKSSQTRIDSFFKLAPSNKSPIKR
QTEDTKSKKSSTGAKRGRRPR
Download sequence
Identical sequences A0A132A620
SSCA009249-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]