SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SSCA010494-PA from Sarcoptes scabiei

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SSCA010494-PA
Domain Number 1 Region: 4-38
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000745
Family EGF-type module 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SSCA010494-PA
Sequence length 85
Comment pep supercontig:SscaA1:JXLN01013297:158:438:-1 gene:SSCA010494 transcript:SSCA010494-RA gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPYKCECKNGGSCLFSQTANKIVCECLSNFDGNLCEDSVSKTKLNTSWLLRTTPSLILLL
LALILAGLVFTIIYFQKKNLFCFHC
Download sequence
Identical sequences A0A132AE23
SSCA010494-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]