SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Spoth1|37261|e_gw1.1.3735.1 from Sporotrichum thermophile ATCC 42464

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Spoth1|37261|e_gw1.1.3735.1
Domain Number 1 Region: 245-333
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000134
Family Eukaryotic type KH-domain (KH-domain type I) 0.0047
Further Details:      
 
Domain Number 2 Region: 529-614
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000471
Family Eukaryotic type KH-domain (KH-domain type I) 0.0038
Further Details:      
 
Weak hits

Sequence:  jgi|Spoth1|37261|e_gw1.1.3735.1
Domain Number - Region: 641-688
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000205
Family Eukaryotic type KH-domain (KH-domain type I) 0.0086
Further Details:      
 
Domain Number - Region: 462-512
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000248
Family Eukaryotic type KH-domain (KH-domain type I) 0.01
Further Details:      
 
Domain Number - Region: 418-483
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0123
Family Eukaryotic type KH-domain (KH-domain type I) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Spoth1|37261|e_gw1.1.3735.1
Sequence length 954
Sequence
MSRSNVGMQAVLNTRRDLATQGPPPIAAPPVPDGPIHYAFNVPFASDLAGPNTEDILHAT
TDAVLRWTHPEEAPDDVPVYELPVHAMNLAQLRQLCHEITANALPIEAHVISTTPKNLNR
QVTTVCLSGAPDLVQQTRETILNTTPLSLRCTTVVVDGNLVANLSQGVLKKSVTDFLDET
SAFCGVDIFLLGPKLSPLTGGLNGDVDLPRDQRWRVAIYGDYLSSEHAKTRVLIHIDQLL
GRIVDATVFEPSMHQLLCGRNRKNIKLIESVTNTAIYFPPPFSACYRYCPPNAQRRDPSK
VLITGENPQDIEQAKFRIHELLTRTRLFVKDVTISPPKIDSILLSRMDKVRKITEANGAF
VMFPSLGSRKGLVRVQAVENLHVERSLREIMSLFYTASWIFLQPDPRQPSNQDIHAMLGD
ICANSDAEVSFDRQSFSITGSDESVKAALMVISKIKFATHTPYQIRVRIELANEHKEFVS
GKKNGKINKIMGNSNVQIMFDNFGEYNFNIEVIAQAYDSLKQGLSLVEQEMPASISFHVP
DQYHKRIIGIGGQHIQRIMKKHSVFVKFSNAMDRGGMGREDDDSRVDNVICRTPARNAQN
LELVKSEILEMVDRADSEFTSQVVSVDRLYHRQLLTRLPEIEELERTWNCKIVFPSTEQA
SDEITVTGPQWLVPKCIDEFLGMVPDKHEVVLERSAPLIKYLESPDFVQNILPKLKTQYE
VELTVHDKSEERTEDGSPTVTLLWTFTRNNAGGLRDAMDFLQTQFTTAGVEPVIIRGAIP
RPKSDTFEESLPYFNSKLLQHAPAPVATDSPTRPSFGEEVARERSILACLRKPGSMSSIS
SFLDRRKNSSQSATNFFKGSSNVSKSSLISIESTRSFNADRNPWNDSGVNLPDEESNPWA
PAPTYVNGVDKLTVPQPGDITPRHHPRQSADSGRPSTSHSTNSGYPGPLAGPFR
Download sequence
Identical sequences jgi|Spoth1|37261|e_gw1.1.3735.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]