SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Spoth1|45773|e_gw1.3.457.1 from Sporotrichum thermophile ATCC 42464

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Spoth1|45773|e_gw1.3.457.1
Domain Number 1 Region: 320-383,458-508
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.71e-18
Family Nuclease 0.079
Further Details:      
 
Domain Number 2 Region: 42-244
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 2.04e-18
Family TrmB middle domain-like 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Spoth1|45773|e_gw1.3.457.1
Sequence length 529
Sequence
MTRPPGLIHEFLRQLESRQSLHSESNPDLPRYDVQNPTDRGLLVTSSRPQRFFLGTGASI
FTNYLIPAITSAQHEVILVTCFWAPSRTLTALCEALSKLAAHRRRLVQEARATGSTPIPP
LHVRICLSSRSLLQKLLHPQSRSGYTYPPASWHKKLGLPEPALLEAGGIRLEAKSLFFLP
FSVMHPKFVIIDRQRAFVPSCNVSWESWLEGCVEITGDAVRALFAFYSRTWEDPADTEPA
RDAWSDRVPGDSEAAGTSWDGAEAGLVMVRSTARLCVDLESHDTVATLVLPSSYHRNPRF
RPFPWQRSPPPPDTPLNIASMQLFERAQRSIYIQTPNLTCESVIIALLDALARGVEVNIV
TNRNMMLLEQLVTAGTTTSWCIRSLIRRFCRPKAALGGKQKAQSGGGDASRDLEAGLPNT
GTRVGRLLIWYFHAKNPSSPGVLEGQPAVATRPQGEEPVHSHLKLALVDAEYALLGSGNL
DRASWFTSQELGILFQSRELCSKIKAAVDGVLEGRLDLIFDSDHGTGSN
Download sequence
Identical sequences G2QA37
XP_003661030.1.50100 jgi|Spoth1|45773|e_gw1.3.457.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]