SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YBR014C from Saccharomyces cerevisiae AWRI1631

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YBR014C
Domain Number - Region: 89-117
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0087
Family Thioltransferase 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YBR014C
Sequence length 119
Comment GRX7 ORF Verified Cis-golgi localized monothiol glutaredoxin; more similar in activity to dithiol than other monothiol glutaredoxins; involved in the oxidative stress response; does not bind metal ions; functional overlap with GRX6
Sequence
MAIVINKRNVRVLVITNLLLIVVFFVLRNSNASVNESITTHHPDSLVTFDNSGNAPGTHQ
SVHDTVNTQDKEAEEVDKNSGDAEFDAAAEYNKIMEQSPMIVFSKTGCPYSKKTESFVD
Download sequence
Identical sequences YBR014C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]