SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YCR083W from Saccharomyces cerevisiae AWRI1631

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YCR083W
Domain Number 1 Region: 16-117
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.22e-34
Family Thioltransferase 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YCR083W
Sequence length 125
Comment TRX3 ORF Verified Mitochondrial thioredoxin, highly conserved oxidoreductase required to maintain the redox homeostasis of the cell, forms the mitochondrial thioredoxin system with Trr2p, redox state is maintained by both Trr2p and Glr1p
Sequence
MLFYKPVMRMAVRPLKSIRFQSSYTSITKLTNLTEFRNLIKQNDKLVIDFYATWCGPCKM
MQPHLTKLIQAYPDVRFVKCDVDESPDIAKECEVTAMPTFVLGKDGQLIGKIIGANPTAL
EKGIK
Download sequence
Identical sequences YCR083W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]