SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YDR098C from Saccharomyces cerevisiae AWRI1631

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR098C
Domain Number 1 Region: 186-274
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.32e-25
Family Thioltransferase 0.00027
Further Details:      
 
Domain Number 2 Region: 30-144
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.88e-24
Family Thioltransferase 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YDR098C
Sequence length 285
Comment GRX3 ORF Verified Hydroperoxide and superoxide-radical responsive glutathione-dependent oxidoreductase; monothiol glutaredoxin subfamily member along with Grx4p and Grx5p; protects cells from oxidative damage
Sequence
MCSFQVPSAFSFNYTSYCYKRHQARYYTAAKLFQEMPVIEINDQEQFTYLTTTAAGDKLI
VLYFHTSWAEPCKALKQVFEAISNEPSNSNVSFLSIDADENSEISELFEISAVPYFIIIH
KGTILKELSGADPKEFVSLLEDCKNSVNSGSSQTHTMENANVNEGSHNDEDDDDEEEEEE
TEEQINARLTKLVNAAPVMLFMKGSPSEPKCGFSRQLVGILREHQVRFGFFDILRDESVR
QNLKKFSEWPTFPQLYINGEFQGGLDIIKESLEEDPDFLQHALQS
Download sequence
Identical sequences A6ZY62 B3LGH6 B5VFZ7 C7GVP0 C8Z515 G2WAK2
YDR098C YDR098C YDR098C SCRT_00418 YDR098C YDR098C YDR098C tr|A6ZY62|A6ZY62_YEAS7 YDR098C YDR098C YDR098C YDR098C YDR098C YDR098C YDR098C YDR098C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]