SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YDR177W from Saccharomyces cerevisiae AWRI1631

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR177W
Domain Number 1 Region: 2-150
Classification Level Classification E-value
Superfamily UBC-like 3.95e-53
Family UBC-related 0.000000167
Further Details:      
 
Domain Number 2 Region: 161-215
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000000219
Family UBA domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YDR177W
Sequence length 215
Comment UBC1 ORF Verified Ubiquitin-conjugating enzyme that mediates selective degradation of short-lived and abnormal proteins; plays a role in vesicle biogenesis and ER-associated protein degradation (ERAD); component of the cellular stress response
Sequence
MSRAKRIMKEIQAVKDDPAAHITLEFVSESDIHHLKGTFLGPPGTPYEGGKFVVDIEVPM
EYPFKPPKMQFDTKVYHPNISSVTGAICLDILKNAWSPVITLKSALISLQALLQSPEPND
PQDAEVAQHYLRDRESFNKTAALWTRLYASETSNGQKGNVEESDLYGIDHDLIDEFESQG
FEKDKIVEVLRRLGVKSLDPNDNNTANRIIEELLK
Download sequence
Identical sequences A0A0L8VTC1 A0A250W8Z1 A6ZYD5 B3LGA6 B5VG72 C7GN20 C8Z590 E7NFT7 E7Q288 G2WAS5 H0GDJ8 N1P6H1 P21734
YDR177W YDR177W YDR177W YDR177W YDR177W YDR177w___KOG0418 YDR177W YDR177W SCRT_00344 YDR177W 4932.YDR177W YDR177W YDR177W tr|A6ZYD5|A6ZYD5_YEAS7 YDR177W YDR177W YDR177W YDR177W YDR177W NP_010462.3.97178 YDR177W YDR177W YDR177W YDR177W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]