SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YDR518W from Saccharomyces cerevisiae AWRI1631

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR518W
Domain Number 1 Region: 32-139
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.75e-26
Family PDI-like 0.0023
Further Details:      
 
Domain Number 2 Region: 333-484
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.56e-23
Family PDI-like 0.0002
Further Details:      
 
Domain Number 3 Region: 239-362
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.69e-22
Family PDI-like 0.0000473
Further Details:      
 
Domain Number 4 Region: 145-238
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.81e-20
Family PDI-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YDR518W
Sequence length 517
Comment EUG1 ORF Verified Protein disulfide isomerase of the endoplasmic reticulum lumen, function overlaps with that of Pdi1p; may interact with nascent polypeptides in the ER
Sequence
MQVTTRFISAIVSFCLFASFTLAENSARATPGSDLLVLTEKKFKSFIESHPLVLVEFFAP
WCLHSQILRPHLEEAASILKEHNVPVVQIDCEANSMVCLQQTINTYPTLKIFKNGRIFDG
QVYRGVKITDEITQYMIQLYEASVIYLNSEDEIQPYLENATLPVVINRGLTGLNETYQEV
ALDLAEDYVFLSLLDSEDKSLSIHLPNTTEPILFDGNVDSLVGNSVALTQWLKVVILPYF
TDIEPDLFPKYISSNLPLAYFFYTSKEELEDYTDLFTQLGKENRGQINFIALNSTMFPHH
VRFLNMREQFPLFAIHNMINNLKYGLPQLPEEEYAKLEKPQPLDRDMIVQLVKDYREGTA
KPIVKSEEIPKEQKSNVYKIVGKTHDDIVHDDDKDVLVKYYATWCIHSKRFAPIYEEIAN
VLASDESVRDKILIAEVDSGANDILSFPVTGYPTIALYPAGNNSKPIIFNKIRNLEDVFE
FIKESGTHHIDGQAIYDKLHQAKDSEVSTEDTVHDEL
Download sequence
Identical sequences A6ZZA5 B3LFF2 C7GKV1 C8Z674 E7KBH1 E7KMC0 E7LT70 E7NGE6 E7Q2U8 E7QDH9 H0GEU5
YDR518W YDR518W YDR518W YDR518W YDR518W YDR518W YDR518W YDR518W tr|A6ZZA5|A6ZZA5_YEAS7 SCRT_00025 YDR518W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]