SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YGR154C from Saccharomyces cerevisiae AWRI1631

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGR154C
Domain Number 1 Region: 182-332
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 9.05e-22
Family Glutathione S-transferase (GST), C-terminal domain 0.013
Further Details:      
 
Domain Number 2 Region: 15-67,133-166
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000246
Family Thioltransferase 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YGR154C
Sequence length 356
Comment GTO1 ORF Verified Omega-class glutathione transferase; induced under oxidative stress; putative peroxisomal localization
Sequence
MSVSYKGTISKTHSVFKPEKGRYYIYGALGCPFTHRAILARSLKKLEPVLGLVLSHWKLD
SKGARFLSAPHRPEKYKERFFTATGGIASAKLDESEELGDVNNDSARLFVDGAFDPVENI
SRLSELYYLNDPKYPGTKFTVPVLWDSKTRKIVNNESGDIIRILNSGVFDEFIQSEETNV
IDLVPHDLIDEIDKNIKWVHPKINLGVYKVGLAENGKIYETEVKTLFENLQKMECVLKEN
YKRLEEQFSGNKQKILAKYFVLGQRLTEADIRLYPSIIRFDVVYVQHFKCNLKTIRDGFP
YLHLWLINLYWNYAEFRFTTDFNHIKLFYIRMEVSRNKINQFGIVPLGPKPDISRL
Download sequence
Identical sequences A0A0L8VQ91 A6ZUG5 B3LI76 B5VJ97 C7GQ62 E7KCM1 E7QF60
YGR154C YGR154C YGR154C YGR154C YGR154C SCRT_00866 YGR154C YGR154C tr|A6ZUG5|A6ZUG5_YEAS7 YGR154C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]