SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YHR193C from Saccharomyces cerevisiae AWRI1631

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YHR193C
Domain Number - Region: 136-173
Classification Level Classification E-value
Superfamily UBA-like 0.000112
Family UBA domain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YHR193C
Sequence length 174
Comment EGD2 ORF Verified Alpha subunit of the heteromeric nascent polypeptide-associated complex (NAC) involved in protein sorting and translocation, associated with cytoplasmic ribosomes
Sequence
MSAIPENANVTVLNKNEKKARELIGKLGLKQIPGIIRVTFRKKDNQIYAIEKPEVFRSAG
GNYVVFGEAKVDNFTQKLAAAQQQAQASGIMPSNEDVATKSPEDIQADMQAAAEGSVNAA
AEEDDEEGEVDAGDLNKDDIELVVQQTNVSKNQAIKALKAHNGDLVNAIMSLSK
Download sequence
Identical sequences A0A0L8VQA6 A0A250WKN2 A6ZT99 B3LSV4 B5VKC1 C7GRL5 C8Z9Z2 E7KDK6 E7KPM7 E7LVI4 E7NIS4 E7Q4W6 E7QFT7 G2WFR6 H0GHM4 N1P9I5 P38879
355384 APC7148 NYSGXRC-P062 YR191 YHR193C YHR193C 4932.YHR193C YHR193C sp|A6ZT99|NACA_YEAS7 YHR193C YHR193C YHR193C YHR193C YHR193C YHR193C YHR193C YHR193C YHR193C YHR193C YHR193C YHR193C NP_012063.3.97178 XP_015331744.1.40921 YHR193C YHR193C YHR193C YHR193C SCRT_04906 YHR193C YHR193C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]