SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YKR076W from Saccharomyces cerevisiae AWRI1631

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YKR076W
Domain Number 1 Region: 28-82,151-183
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000000207
Family Glutathione S-transferase (GST), N-terminal domain 0.068
Further Details:      
 
Domain Number 2 Region: 194-256
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 0.00000182
Family Glutathione S-transferase (GST), C-terminal domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YKR076W
Sequence length 274
Comment ECM4 ORF Verified Omega class glutathione transferase; not essential; similar to Ygr154cp; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm
Sequence
MSKQWASGTNGAFKRQVSSFRETISKQHPIYKPAKGRYWLYVSLACPWAHRTLITRALKG
LTSVIGCSVVHWHLDEKGWRFLDMEKQLEDSEDFLEHWHDVAGGIRTAKEDSSKSFAEIK
NDSQRFMVDATNEPHYGYKRISDLYYKSDPQYSARFTVPVLWDLETQTIVNNESSEIIRI
LNSSAFDEFVDDDHKKTDLVPAQLKTQIDDFNSWVYDSINNGVYKTGFAEKAEVYESEVN
NVFEHLDKVEKILSDKYSKLKAKYGEEDRQKILG
Download sequence
Identical sequences B5VMM0
YKR076W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]