SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YPR082C from Saccharomyces cerevisiae AWRI1631

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YPR082C
Domain Number 1 Region: 7-138
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.9e-31
Family spliceosomal protein U5-15Kd 0.00000688
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YPR082C
Sequence length 143
Comment DIB1 ORF Verified 17-kDa component of the U4/U6aU5 tri-snRNP, plays an essential role in pre-mRNA splicing, orthologue of hDIM1, the human U5-specific 15-kDa protein
Sequence
MASVLLPQLRTGWHVDQAIVTETKRLVVIRFGRKNDRQCMIMDELLSSIAERVRNFAVIY
LCDIDEVSDFDEMYELTDPMTVMFFYQNKHMMCDFGTGNNNKLNFIVDDKQEMIDILETI
FRGARKNKGLVVSPYDYNHKRVS
Download sequence
Identical sequences A0A0L8VG54 A0A250WE14 A6ZWW7 B3LK52 C7GPS5
YPR082C tr|A6ZWW7|A6ZWW7_YEAS7 YPR082C YPR082C YPR082C YPR082C YPR082C YPR082C YPR082C YPR082C YPR082C SCRT_02564 YPR082C YPR082C YPR082C YPR082C YPR082C YPR082C YPR082C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]