SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YOR138C from Saccharomyces cerevisiae AWRI1631

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOR138C
Domain Number 1 Region: 2-42
Classification Level Classification E-value
Superfamily UBA-like 0.000000000952
Family UBA domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YOR138C
Sequence length 671
Comment RUP1 ORF Verified Protein involved in regulation of Rsp5p, which is an essential HECT ubiquitin ligase; has a WW domain consensus motif of PPPSY (residues 131-135) that mediates binding of Rsp5p to Ubp2p; contains an UBA domain
Sequence
MMDNQAVKSLLEMGIPHEVAVDALQRTGGNLEAAVNFIFSNELPEQAEMGEENGGSQPRI
FENKIVAGTKPCNVPNNGDQDIEMPDVSGVDVDYDDDEDITDERSGSNSTSGCRVTAQDY
DRYSISETSIPPPSYSIVQHNEFKSNVGDPTVVLPLPLNSLIESYFGLFALLAAVYFPHV
FLKPDFKDLNYRADWFKSSSFTEPKYRLAYCEAEDGSTTSEIVLASGPNEGLQPHLLWQL
QKLISVVNTRKCERAFVSAKVFTSSLEPQLRSKLADSEHLYEVLPAFIKSLAVDLEMCPG
IRDRETRSLFISSALHTPNKNEPPMETFLSLFHFLPEEYDSNLYKMFNVLLYPEEEEEEE
DVIRGGEQEEARYVEPENTLKEVAPVLTILFNELETNTESVSLPNGVDIPLEFYPQLYTK
QCKDQLIRHIISKRKQARTRSRCLLQEINELKSYQGKNISTILESTLAYLQTIPDDANNE
AAKQIASLKDTLNSARAAKMEEYKDLASKLHGEWNLSHPETHIINTAKQLGLIENPYILT
MAALSPYSYFIRSRNGAWSWIQSNTLGTEFKVKKCSSPSVVQEAIKHGTKYASETPLMFI
YCEEGKIPTEEVVAEALKSNSGCLKFAEDDQNSLKTLRSQFFDGMGDPEQATNNINNGND
NDNDDDIDSDN
Download sequence
Identical sequences B5VS26
YOR138C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]