SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YDR206W from Saccharomyces cerevisiae CBS7960

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR206W
Domain Number 1 Region: 30-585
Classification Level Classification E-value
Superfamily TPR-like 1.21e-52
Family Tetratricopeptide repeat (TPR) 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YDR206W
Sequence length 884
Comment EBS1 ORF Verified Protein involved in inhibition of translation and nonsense-mediated decay; interacts with cap binding protein Cdc33p and with Nam7p; localizes to P-bodies upon glucose starvation; mRNA abundance regulated by mRNA decay factors
Sequence
MEPSNTQKEDLPTAFNGIKSQLNSILKSNQLFQDYALLNGFLAFVHSKLNAAILTSIESQ
CGKSFAADLDSFDQSSISSILDFSWESVHYPIFKWFQMWRNYILFEKENKKQQTKFIDFR
KMNSKMLKFFKTVQNFYVNVINTVYKKYDISVLLPKRIIQDLKLSDIENTTNVGDILAVK
TFNSSSPLAHLIPTLFHRCLLFLGTAYRYKTLLEEISNKYSISNFKKSLDFFRLASLVLP
SAGETYSQAGAIFLQTGNLGIAVFNFVKGMMTKMPSPVSIKNFGALMVDNKSSLNRSLHT
TIMNTYLQESKGPRTPAKEILEFYFLGLFGSVWSPTSWRDDTKPNQLNNGIKLRHLENAL
YETMSARYLNNIKTIFHNLIITIGGFHLLLKRRSDVSAKTLKDLRSNELDYLNFAFKYIA
HILNDIVKESWSENPEVSEILGMVRIINCWIKANPMVLQYSQSNLEFVNALAYLINDIVK
KKPSPSFSITEHIPKRTYWFEEDLMVKGLSFVNFQLSDFDDYEKILEMDHSLDRLIGNPP
LCDKLSASSEMLLRLQAVVNISSQLLQNNNCGVEWSDNKSRYIFNKKIGFKETVKNSMKT
SKQSNEKAKLQRKNKPSTTNGSISMADLERQMRSSSLDSFSPTMGYSGSSVPMAPDTFNV
KPSGTITGNKVNVELLKIELSGQNADGAITNISPGYSNAAISSSNSTDESSFDLNNILSS
MQQKHAEKSFAKSMQGVNEQIPANDVCHQAQRPMQGGLYSSQQPSSMSSLNSAYQNASMP
PSASMVSYPYPFLNQQGQGVFPPYNAQNLQWQSEAYSLKSMNFANPTWLGDQYQTSAPSS
AYAQAQRQMFQQPMQQDVGKYMQFPFDAQSNTDSMRGNSRNNMF
Download sequence
Identical sequences N1P8E2 Q03466
YDR206W YDR206W 4932.YDR206W YDR206W NP_010492.3.97178 YDR206W YDR206w

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]