SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YGL105W from Saccharomyces cerevisiae CBS7960

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGL105W
Domain Number 1 Region: 207-347
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.37e-42
Family Myf domain 0.0000126
Further Details:      
 
Domain Number 2 Region: 15-115
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 9.18e-27
Family Arc1p N-terminal domain-like 0.0000024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YGL105W
Sequence length 376
Comment ARC1 ORF Verified Protein that binds tRNA and methionyl- and glutamyl-tRNA synthetases (Mes1p and Gus1p), delivering tRNA to them, stimulating catalysis, and ensuring their localization to the cytoplasm; also binds quadruplex nucleic acids
Sequence
MSDLVTKFESLIISKYPVSFTKEQSAQAAQWESVLKSGQIQPHLDQLNLVLRDNTFIVST
LYPTSTDVHVFEVALPLIKDLVASSKDVKSTYTTYRHILRWIDYMQNLLEVSSTDKLEIN
HDLDLPHEVIEKKKKAPAGGAADAAAKADEDVSKKAKKQDHPRGKPDEETLKKLREEAKA
KKAAKKAANAKQQQEQQNKAPEKPKPSAIDFRVGFIQKAIKHPDADSLYVSTIDVGDEEG
PRTVCSGLVKHFPLDAMQERYVVVVCNLKPVNMRGIKSTAMVLCGSNDDKVEFVEPPKDS
KAGDKVFFEGFGDEAPMKQLNPKKKIWEHLQPHFTTNDGLEVIFKDEEEKDHPVRKLTNA
KGESFKVASIANAQVR
Download sequence
Identical sequences A0A0L8VQK8 B3LHG9 B5VIM1 C7GM22 C8Z8E3 E7KCF9 E7KND8 E7LUB0 H0GG58 N1P5E2 P46672
YGL105W YGL105W NP_011410.1.97178 YGL105W YGL105W YGL105W YGL105W CX00001 CX00002 4932.YGL105W SCRT_01102 YGL105W YGL105W YGL105W YGL105W YGL105W YGL105W YGL105W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]