SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YML094W from Saccharomyces cerevisiae CBS7960

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YML094W
Domain Number 1 Region: 14-139
Classification Level Classification E-value
Superfamily Prefoldin 7.06e-27
Family Prefoldin 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YML094W
Sequence length 163
Comment GIM5 ORF Verified Subunit of the heterohexameric cochaperone prefoldin complex which binds specifically to cytosolic chaperonin and transfers target proteins to it
Sequence
MSSQKIDLTKLNPEQLNAVKQQFDQELQHFTQSLQALTMAKGKFTECIDDIKTVSQAGNE
GQKLLVPASASLYIPGKIVDNKKFMVDIGTGYYVEKSAEAAIAFYQKKVDKLNKESVQIQ
DIIKEKTQYSLSIEAQIRQAAIRQHEAMSKQQQQQQKKESSTA
Download sequence
Identical sequences A6ZLX3 B3LLG4 G2WJW3 N1P5X4 Q04493
YML094W SCRT_01806 YML094W tr|A6ZLX3|A6ZLX3_YEAS7 YML094W YML094W YML094W YML094W NP_013616.1.97178 YML094W YML094W YML094W YML094W YML094W YML094W YML094W YML094w___KOG3048 4932.YML094W YML094W YML094W YML094W YML094W YML094W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]