SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YBL078C from Saccharomyces cerevisiae CLIB215

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBL078C
Domain Number 1 Region: 1-116
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.27e-41
Family GABARAP-like 0.0000337
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YBL078C
Sequence length 117
Comment ATG8 ORF Verified Component of autophagosomes and Cvt vesicles; undergoes conjugation to phosphatidylethanolamine (PE); Atg8p-PE is anchored to membranes, is involved in phagophore expansion, and may mediate membrane fusion during autophagosome formation
Sequence
MKSTFKSEYPFEKRKAESERIADRFKNRIPVICEKAEKSDIPEIDKRKYLVPADLTVGQF
VYVIRKRIMLPPEKAIFIFVNDTLPPTAALMSAIYQEHKDKDGFLYVTYSGENTFGR
Download sequence
Identical sequences A0A0L8VW29 A0A250WF75 A6ZKM4 B3LNL0 C7GK56 C8Z3R6 E7K997 E7KK10 E7LRA2 E7NEL9 E7Q0Q6 E7QB75 G2W8T4 H0GC30 N1P6W4 P38182
YBL078C YBL078C YBL078C YBL078C YBL078C d2kq7a1 YBL078C NP_009475.1.97178 YBL078C YBL078C 4932.YBL078C YBL078C SCRT_03038 YBL078C YBL078c YBL078C YBL078C YBL078C YBL078C YBL078C YBL078C YBL078C YBL078c___KOG1654 YBL078C YBL078C YBL078C YBL078C sp|A6ZKM4|ATG8_YEAS7 YBL078C YBL078C YBL078C YBL078C YBL078C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]