SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YBR217W from Saccharomyces cerevisiae CLIB215

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBR217W
Domain Number 1 Region: 102-185
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.12e-25
Family APG12-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YBR217W
Sequence length 186
Comment ATG12 ORF Verified Conserved ubiquitin-like modifier involved in autophagy and the Cvt pathway; conjugated to Atg5p to form a complex involved in Atg8p lipidation; Atg12p-Atg5p also forms a complex with Atg16p that is required for autophagosome formation
Sequence
MSRILESENETESDESSIISTNNGTAMERSRNNQELRSSPHTVQNRLELFSRRLSQLGLA
SDISVDQQVEDSSSGTYEQEETIKTNAQTSKQKSHKDEKNIQKIQIKFQPIGSIGQLKPS
VCKISMSQSFAMVILFLKRRLKMDHVYCYINNSFAPSPQQNIGELWMQFKTNDELIVSYC
ASVAFG
Download sequence
Identical sequences A0A0L8VUV4 A6ZLF7 B3LMU3 C7GUY9 D3UEW3 E7KK67 E7QBN9 H0GCR8 N1PAV3 P38316
YBR217W YBR217W YBR217W YBR217W YBR217W YBR217W YBR217W YBR217W SCRT_02753 YBR217W YBR217W YBR217W YBR217W YBR217W NP_009776.1.97178 YBR217W YBR217W sp|A6ZLF7|ATG12_YEAS7 YBR217W 4932.YBR217W YBR217W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]