SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YBR244W from Saccharomyces cerevisiae CLIB215

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBR244W
Domain Number 1 Region: 3-160
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.36e-62
Family Glutathione peroxidase-like 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YBR244W
Sequence length 162
Comment GPX2 ORF Verified Phospholipid hydroperoxide glutathione peroxidase induced by glucose starvation that protects cells from phospholipid hydroperoxides and nonphospholipid peroxides during oxidative stress
Sequence
MTTSFYDLECKDKKGESFKFDQLKGKVVLIVNVASKCGFTPQYKELEELYKKYQDKGFVI
LGFPCNQFGKQEPGSDEQITEFCQLNYGVTFPIMKKIDVNGSNADSVYNYLKSQKAGLLG
FKGIKWNFEKFLVDSNGKVVQRFSSLTKPSSLDQEIQSLLSK
Download sequence
Identical sequences A0A0L8VUT3 A0A250WG19 A6ZLI3 B3LMR8 C7GMY7 E7LRQ3 E7QBQ9 N1P8J4 P38143
YBR244W YBR244W YBR244W YBR244W YBR244W 4932.YBR244W YBR244W YBR244W YBR244W YBR244W NP_009803.3.97178 XP_015332218.1.40921 YBR244W YBR244W YBR244W tr|A6ZLI3|A6ZLI3_YEAS7 YBR244W YBR244W YBR244W YBR244W SCRT_02726 YBR244W YBR244W YBR244W YBR244W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]