SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YCL032W from Saccharomyces cerevisiae CLIB215

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YCL032W
Domain Number 1 Region: 107-186
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000241
Family Ras-binding domain, RBD 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YCL032W
Sequence length 205
Comment STE50 ORF Verified Protein involved in mating response, invasive/filamentous growth, and osmotolerance, acts as an adaptor that links G protein-associated Cdc42p-Ste20p complex to the effector Ste11p to modulate signal transduction
Sequence
MDVLEVMKTISNSSPINTHGVSTTVPSSNNTIIPSSDGVSLSQTDYFDTVHNRQSPSRRE
SPVTVFRQPSLSHSKSLHKDSKNKVPQISTNQSHPSAVSTANTPGPSPNEALKQLRASKE
DSCERILKNAMKRHNLADQDWRQYVLVICYGDQERLLELNEKPVIIFKNLKQQGLHPAIM
LRRRGDFEEVAMMNGSDNVTPGGRL
Download sequence
Identical sequences YCL032W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]