SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YCR060W from Saccharomyces cerevisiae CLIB215

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YCR060W
Domain Number 1 Region: 3-68
Classification Level Classification E-value
Superfamily TPR-like 2.74e-17
Family Tetratricopeptide repeat (TPR) 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YCR060W
Sequence length 101
Comment TAH1 ORF Verified HSP90 cofactor; interacts with Hsp82p, Pih1p, Rvb1 and Rvb2, contains a single TPR domain with at least two TPR motifs
Sequence
MSQFEKQKEQGNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQM
CQQGLRYPSTAEHVAIKSQIAISSKAGTGSGRFNTNPCCRG
Download sequence
Identical sequences YCR060W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]