SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YDR510W from Saccharomyces cerevisiae CLIB215

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR510W
Domain Number 1 Region: 13-98
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.65e-31
Family Ubiquitin-related 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YDR510W
Sequence length 101
Comment SMT3 ORF Verified Ubiquitin-like protein of the SUMO family, conjugated to lysine residues of target proteins; regulates chromatid cohesion, chromosome segregation, APC-mediated proteolysis, DNA replication and septin ring dynamics; phosphorylated at Ser2
Sequence
MSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEM
DSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGGATY
Download sequence
Identical sequences A6ZZ98 B3LFF9 C7GKU4 C8Z666 E7KBG7 E7KMB3 E7LTD5 E7NGD9 E7Q2T0 E7QDH3 G2WBN7 H0GET8 N1P5U8 Q12306
4932.YDR510W YDR510W YDR510W 1l2nA YDR510W NP_010798.1.97178 YDR510W YDR510W YDR510W YDR510W YDR510W YDR510W tr|A6ZZ98|A6ZZ98_YEAS7 YDR510W 1l2n_A ORFP:5381 YDR510W YDR510W SCRT_00033 YDR510W YDR510W YDR510W YDR510W YDR510W YDR510W YDR510W YDR510w___KOG1769 YT13 YDR510W YDR510W YDR510W YDR510W YDR510W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]