SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YEL037C from Saccharomyces cerevisiae CLIB215

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YEL037C
Domain Number 1 Region: 1-76
Classification Level Classification E-value
Superfamily Ubiquitin-like 7.83e-18
Family Ubiquitin-related 0.0032
Further Details:      
 
Domain Number 2 Region: 249-317
Classification Level Classification E-value
Superfamily XPC-binding domain 2.75e-16
Family XPC-binding domain 0.0000722
Further Details:      
 
Domain Number 3 Region: 132-189
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000225
Family UBA domain 0.0025
Further Details:      
 
Domain Number 4 Region: 349-397
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000125
Family UBA domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YEL037C
Sequence length 398
Comment RAD23 ORF Verified Protein with ubiquitin-like N terminus, subunit of Nuclear Excision Repair Factor 2 (NEF2) with Rad4p that recognizes and binds damaged DNA; enhances protein deglycosylation activity of Png1p; homolog of human HR23A and HR23B
Sequence
MVSLTFKNFKKEKVPLDLEPSNTILETKTKLAQSISCEESQIKLIYSGKVLQDSKTVSEC
GLKDGDQVVFMVSQKKSTKTKVTEPPIAPESATTPGRENSTEASPSTDASAAPAATAPEG
SQPQEEQTATTERTESASTPGFVVGTERNETIERIMEMGYQREEVERALRAAFNNPDRAV
EYLLMGIPENLRQPEPQQQTAAAAEQPSTAATTAEQPAEDDLFAQAAQGGNASSGALGTT
GGATDAAQGGPPGSIGLTVEDLLSLRQVVSGNPEALAPLLENISARYPQLREHIMANPEV
FVSMLLEAVGDNMQDVMEGADDMVEGEDIEVTGEAAAAGLGQGEGEGSFQVDYTPEDDQA
ISRLCELGFERDLVIQVYFACDKNEEAAANILFSDHAD
Download sequence
Identical sequences A0A0L8VS23 A0A250WJL2 A6ZQR3 B3LRY0 E7KBK5 E7NGS2 G2WCJ6 H0GFD3 N1P5J9 P32628
YEL037C YEL037C YEL037C NP_010877.3.97178 tr|A6ZQR3|A6ZQR3_YEAS7 YEL037C YEL037C CX00028 NYSGXRC-T637 YEL037C SCRT_04434 YEL037C YEL037C YEL037C YEL037C 4932.YEL037C YEL037C YEL037C YEL037C YEL037C YEL037C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]