SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YIL148W from Saccharomyces cerevisiae CLIB215

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YIL148W
Domain Number 1 Region: 1-87
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.63e-64
Family Ubiquitin-related 0.0071
Further Details:      
 
Domain Number 2 Region: 76-128
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 1.64e-17
Family Ribosomal protein L40e 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YIL148W
Sequence length 128
Comment RPL40A ORF Verified Fusion protein, identical to Rpl40Bp, that is cleaved to yield ubiquitin and a ribosomal protein of the large (60S) ribosomal subunit with similarity to rat L40; ubiquitin may facilitate assembly of the ribosomal protein into ribosomes
Sequence
MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGIIEPSLKALASKYNCDKSVCRKCYARLPPRATNCRKRKCGHTNQ
LRPKKKLK
Download sequence
Identical sequences A0A0L8VLJ1 A0A1X7R9K8 A0A250WM05 A6ZVC8 B3LRG8 C8ZAW5 G2WG04 H2AYM5 N1P2T8 P0CH08 P0CH09
4932.YIL148W 4932.YKR094C YIL148W YKR094C YIL148W YKR094C tr|A6ZVC8|A6ZVC8_YEAS7 YIL148W YKR094C YIL148W YKR094C YIL148W YKR094C YKR094C YIL148W YKR094C YIL148W YKR094C YIL148W YKR094C YIL148W YIL148W YKR094C YIL148W YIL148W YIL148W YKR094C YIL148W YKR094C YIL148W YKR094C YIL148W YKR094C YIL148w___KOG0003 YIL148W YKR094C NP_012118.1.97178 NP_013020.3.97178 XP_003957005.1.94514 XP_003958566.1.94514 YIL148W YKR094C 3j6x_80 3j6y_80 3j77_90 3j78_90 4v88_Bm 4v88_Dm 4v8t_m 4v8y_Bm 4v8z_Bm 4v91_m 5apn_m 5apo_m 5gak_o 5juo_RA 5jup_RA 5jus_RA 5jut_RA 5juu_RA 5mc6_AO 5t62_z 5t6r_z 6ef3_u YIL148W YIL148W YKR094C YIL148W YKR094C YIL148W YKR094C YIL148W YKR094C YIL148W YKR094C SCRT_04110 SCRT_05321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]