SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YJL048C from Saccharomyces cerevisiae CLIB215

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YJL048C
Domain Number 1 Region: 133-268
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.91e-20
Family UBX domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YJL048C
Sequence length 396
Comment UBX6 ORF Verified UBX (ubiquitin regulatory X) domain-containing protein that interacts with Cdc48p, transcription is repressed when cells are grown in media containing inositol and choline
Sequence
MYEMSGIDSLFHDRVVHDYSHTSEQVIVVYISSAAGDNSWLHQWFKPGNLSDEERENILW
VRLVNGTKECLLFKSIFPSSSAPSINILQNGLLECSIQGNSLSREQDPWETFINGLQSVF
KGQVTKRKLFSKSNEEYQRVKRMIQNDKLERKYVFQNTNDPQRKPQKWKQLTVTDNVSYK
SQKGFLAQNYCTLQLKLPNGYTISNTFPPQTKLHKVRMWLDYNCYDDGTPYLFHRNIPRV
TLTRNDELKSLQELDLLPRSTLILEPLEANNKTFDYMEQSSLLHKVYSGLTSFWAKEPEV
DASSSRLGYQRLGTNVSNSANYSLQKLSSLDMVSDGGGGGGGDSMTPSAYTTPRMYPSNG
TSQLRQNVSELNLSSNNSASNTKVRTLGYSNNNGNN
Download sequence
Identical sequences A0A0L8VN40 A6ZPS8 B3LQ63 C8ZBB2 E7KEB0 E7KQD8 E7LW99 E7NJQ0 G2WGW9 N1NZW5 P47049
YJL048C YJL048C YJL048C YJL048C YJL048C YJL048C YJL048C YJL048C NP_012487.1.97178 YJL048C 4932.YJL048C YJL048C SCRT_03623 tr|A6ZPS8|A6ZPS8_YEAS7 YJL048C YJL048C YJL048C YJL048C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]