SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YKR096W from Saccharomyces cerevisiae CLIB215

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YKR096W
Domain Number 1 Region: 19-215,306-360,387-484
Classification Level Classification E-value
Superfamily TPR-like 1.59e-38
Family Tetratricopeptide repeat (TPR) 0.041
Further Details:      
 
Weak hits

Sequence:  YKR096W
Domain Number - Region: 623-685,712-774
Classification Level Classification E-value
Superfamily PIN domain-like 0.00275
Family PIN domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YKR096W
Sequence length 791
Comment ORF Verified Protein of unknown function that may interact with ribosomes, based on co-purification experiments; green fluorescent protein (GFP)-fusion protein localizes to the nucleus and cytoplasm; predicted to contain a PINc domain
Sequence
MAILGNSFIKLSISEWVYLFWSFIDWKLSAEHWYTEAMKYIYNHGKLYYHMSTVQQNTLE
AFVNLGKSVFCQETFTPSPQYMQLVIDNIYQRAFVERNNGNLRNSLLIEYLKHSEAMLLP
SFLESPDLQNVVLSYFIEKFGIDANGCNIFNAEDMFVQNPDFFKYFFRHGPSFAQSHILQ
IVGFGEPKNPFAILFELPKYLKERKDKKERKKSSNNDSSVTESSTGNSRNDNEDDDEIMS
STTSISDHDLLAEFFNDIDTLRRPILPSMLTNEAWLETLKFLNMTSLKCGIIVLQKFLHG
PLGIALPHILPWIYFIISICLKSSQLSDPVSKEFWMIIVKRAFPWDTMVTFMNVLIVYLL
DNQTSNSIIGDLCDEYDKLSLSELLELFNEGEELPEILGCWGTLWFDTICEKNTHSISSE
DNFQEIGIKDYMALDSPTDGIIFDEKDENGEKFWKRACRTIFLFRELSRSFPIGVIIRND
PLIYRSSFQNTNILGSLVFKLEPLCNIHNNIPVLGALESIIDISEARSENNTDLHAVPEL
SVNEGDNIFHYVGYKKLRADYTCFDKNGEFLSASLYTTWYVPNSNNTNIEDNINYNSEKE
NEGLFLECIKSDYPEIDFKTTYFVFDATSWLRHSARIFKLAQNRLLRFAICLTTFQELRF
LRKSKDENVMEAATRGIITIRQLYYENKVLPLRFTGNVATHIEENLEFEEQITWRTHVDE
FVIESVMKAQEKLESASEPRLSPRRFNYVVLISDDDAMKKKAEEKEIKTLSTRFVFSLCT
KLGEQRHLCTD
Download sequence
Identical sequences YKR096W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]