SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YML046W from Saccharomyces cerevisiae CLIB215

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YML046W
Domain Number 1 Region: 77-484
Classification Level Classification E-value
Superfamily TPR-like 2.28e-26
Family HAT/Suf repeat 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YML046W
Sequence length 629
Comment PRP39 ORF Verified U1 snRNP protein involved in splicing, contains multiple tetriatricopeptide repeats
Sequence
MPDETNFTIEDIEPRPDALRGLDTQFLHDNTALVQAYRGLDWSDISSLTQMVDVIEQTVV
KYGNPNDSIKLALETILWQILRKYPLLFGFWKRFATIEYQLFGLKKSIAVLATSVKWFPT
SLELWCDYLNVLCVNNPNETDFIRNNFEIAKDLIGKQFLSHPFWDKFIEFEVGQKNWHNV
QRIYEYIIEVPLHQYARFFTSYKKFLNEKNLKTTRNIDIILRKTQTTVNEIWQFESKIKQ
PFFNLGQVLNDDLENWSRYLKFVTDPSKSLDKEFVMSVFDRCLIPCLYHENTWMMYIKWL
TKKNISDEVVVDIYQKANTFLPLDFKTLRYDFLRFLKRKYRSNNTLFNNIFNETVSRYLK
IWPNDILLMTEYLCMLKRHSFKNSLDQSPKEILEKQTSFTKILETSISNYINNQIDAKVH
LQTLINDKNLSIVVVELIKTTWLVLKNNMQTRKYFNLYQKNILIKNSVPFWLTYYKFEKS
NVNFTKLNKFIRELGVEIYLPTTVMNDILTDYKTFYLTHSNIVTYESSIIDSNTFDPILY
PELKMSNPKYDPVLNTTANVDWHKKTEWKEAGHIGITTERPQISNSIIECNSGTLIQKPI
SLPNFRNLEKINQVKMNDLYTEEFLKEGK
Download sequence
Identical sequences A0A0L8VK05 A6ZM21 B3LLL1 B5VP84 E7QIZ4
tr|A6ZM21|A6ZM21_YEAS7 YML046W YML046W YML046W YML046W YML046W SCRT_01854 YML046W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]