SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YMR067C from Saccharomyces cerevisiae CLIB215

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YMR067C
Domain Number 1 Region: 3-76
Classification Level Classification E-value
Superfamily Ubiquitin-like 6.41e-16
Family UBX domain 0.028
Further Details:      
 
Domain Number 2 Region: 263-310
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000299
Family UBX domain 0.078
Further Details:      
 
Weak hits

Sequence:  YMR067C
Domain Number - Region: 92-176
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0538
Family Ubiquitin-related 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YMR067C
Sequence length 313
Comment UBX4 ORF Verified UBX (ubiquitin regulatory X) domain-containing protein that interacts with Cdc48p
Sequence
MPMVTVKYNFQLFKCKVSLNSTLNDVLHQSIQFFQLHTSSNDWSLIHLDKPVPLDLPWRL
LNLPTGVNLELSKSSNFPVANKTNREDIPFNMIKIRFQIPGRDSVVKEMLSDQPIAPILR
QMSGAAGDDFKIQVFSKIIEFKTIKDENLTLENLGIQEPSSVRLIFNNTSHSEGISANSA
IHPKQTPPTMTNPETVASLPPHELHKPSVFLPSDEPLAVIKDQIEDEEDYELTVEQAKKY
QKMLSSKAGTLGGPILTKRLREQSANNLPKKNKAISECLLRVKFPDRSHIQIAFKPNEDM
RTVYNVVSQFPDR
Download sequence
Identical sequences YMR067C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]