SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YNL148C from Saccharomyces cerevisiae CLIB215

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YNL148C
Domain Number 1 Region: 106-231
Classification Level Classification E-value
Superfamily Cap-Gly domain 1.83e-22
Family Cap-Gly domain 0.00096
Further Details:      
 
Domain Number 2 Region: 1-93
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000517
Family Ubiquitin-related 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YNL148C
Sequence length 254
Comment ALF1 ORF Verified Alpha-tubulin folding protein, similar to mammalian cofactor B; Alf1p-GFP localizes to cytoplasmic microtubules; required for the folding of alpha-tubulin and may play an additional role in microtubule maintenance
Sequence
MVRVVIESELVRTEKELPNSLKLRQFKDRLYHVTGVEPEDMEIVVKRQYDNKEIYSTKKG
GAYSNEDEDANFLKGEEELIVVVTDSNAQSISNQLATQAEGIPSMEVISEEDYLRRDQSV
LRWKMAHGYGRFNAAQQSQRAALAKQDEAYAREQLTAAIGRHCRVTVDGSAPREAILRYV
GPLPLDVMGTWCGVEFPEAAGKNDGRINGVTLFGPVAPGHGSFVRPRAVEILSKDEESAE
VEDVHDDVESDDEI
Download sequence
Identical sequences A0A0L8VIT0 B3LP04 C7GXU9 E7Q8D8 E7QJW0 N1P498 P53904
YNL148C SCRT_03283 YNL148C YNL148C YNL148c NP_014251.1.97178 YNL148C YNL148C YNL148C YNL148C YNL148C YNL148C YNL148C YNL148C 4932.YNL148C YNL148C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]