SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YOL145C from Saccharomyces cerevisiae CLIB215

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOL145C
Domain Number 1 Region: 46-273
Classification Level Classification E-value
Superfamily HCP-like 4.18e-17
Family HCP-like 0.014
Further Details:      
 
Domain Number 2 Region: 537-717
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000000806
Family Tetratricopeptide repeat (TPR) 0.019
Further Details:      
 
Domain Number 3 Region: 296-485
Classification Level Classification E-value
Superfamily TPR-like 0.000000000548
Family Tetratricopeptide repeat (TPR) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YOL145C
Sequence length 937
Comment CTR9 ORF Verified Component of the Paf1p complex that binds to and modulates the activity of RNA polymerases I and II; required for expression of a subset of genes, including cyclin genes; contains TPR repeats
Sequence
MLATVELYYQRGHYDKALETSDLFVKSIHAEDHRSGRQSKPNCLFLLLRAKLLYQKKNYM
ASLKIFQELLVINPVLQPDPRIGIGLCFWQLKDSKMAIKSWQRALQLNPKNTSASILVLL
GEFRESFTNSTNDKTFKEAFTKALSDLNNIFSENQHNPVLLTLLQTYYYFKGDYQTVLDI
YHHRILKMSPMIAKIVLSESSFWCGRAHYALGDYRKSFIMFQESLKKNEDNLLAKLGLGQ
TQIKNNLLEESIITFENLYKTNESLQELNYILGMLYAGKAFDAKTAKNTSAKEQSNLNEK
ALKYLERYLKLTLATKNQLVISRAYLVISQLYELQNQYKTSLDYLSKALEEMEFIKKEIP
LEVLNNLACYHFINGDFIKADDLFKQAKAKVSDKDESVNITLEYNIARTNEKNDCEKSES
IYSQVTSLHPAYIAARIRNLYLKFAQSKIEDSDMSTEMNKLLDLNKSDLEIRSFYAWYLK
NSKERKNNEKSTTHNKETLVKYNSHDAYALISLANLYVTIARDGKKSRNPKEQEKSKHSY
LKAIQLYQKILQVDPFNIFAAQGLAIIFAESKRLGPALEILRKVRDSLDNEDVQLNLAHC
YLEMREYGKAIENYELVLKKFDNEKTRPHILNLLGRAWYARAIKERSVNFYQKALENAKT
ALDLFVKESSKSKFIHSVKFNIALLHFQIAETLRRSNPKFRTVQQIKDSLEGLKEGLELF
RELNDLKEFNMIPKEELEQRIQLGETTMKSALERSLNEQEEFEKEQSAKIDEARKILEEN
ELKEQERMKQEEEARRLKLEKQAEEYRKLQDEAQKLIQEREAMAISEHNVKDDSDLSDKD
NEYDEEKPRQKRKRSTKTKNSGESKRRKAAKKTLSDSDEDDDDVVKKPSHNKGKKSQLSN
EFIEDSDEEEAQMSGSEQNKNDDNDENNDNDDNDGLF
Download sequence
Identical sequences YOL145C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]