SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YPL149W from Saccharomyces cerevisiae CLIB215

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YPL149W
Domain Number - Region: 180-280
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00448
Family GABARAP-like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YPL149W
Sequence length 294
Comment ATG5 ORF Verified Conserved protein involved in autophagy and the Cvt pathway; undergoes conjugation with Atg12p to form a complex involved in Atg8p lipidation; conjugated Atg12p also forms a complex with Atg16p that is essential for autophagosome formation
Sequence
MNDIKQLLWNGELNVLVSIDPSFLMKGSPREIAVLRIRVPRETYLVNYMPLIWNKIKSFL
SFDPLTDSEKYFWFEHNKTPIPWNYPVGVLFDCLAGKSATFTTSFENQVKDVLTFLRIHL
VMGDSLPPTIIPIASSKTQAEKFWFHQWKQVCFILNGSSKAIMSLSVNEARKFWGSVITR
NFQDFIEISNKISSSRPRHIPLIIQTSRTSGTFRISQPTISMTGVNPTLKDIEGDILDVK
EGINGNDVMVICQGIEIPWHMLLYDLYSKLRSFDGFLYITLVPIKGGDKASSEL
Download sequence
Identical sequences A0A0L8VFV6 B3LKS9 B5VT21 C7GJA0 N1NVU7 Q12380
YPL149W YPL149W YPL149W YPL149W YPL149W YPL149W YPL149w YT238 YPL149W 4932.YPL149W SCRT_02348 YPL149W NP_015176.1.97178 YPL149W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]