SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YDR104C from Saccharomyces cerevisiae CLIB215

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR104C
Domain Number 1 Region: 1029-1098,1191-1225
Classification Level Classification E-value
Superfamily PH domain-like 0.0000576
Family Pleckstrin-homology domain (PH domain) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YDR104C
Sequence length 1245
Comment SPO71 ORF Verified Meiosis-specific protein of unknown function, required for spore wall formation during sporulation; dispensable for both nuclear divisions during meiosis
Sequence
MDSIVNVVEDDVKYAQRVTSFSSPQNANVKVFTIPRHSFTAFRLSYVSPTELSACSQVTL
LGGIPKQWYADQNNQVWKLLTKISLRKVRKQSDMLRRYGYGTIYKKRVGKIPTALYLRKH
FTWSYEDNTSIHNGHRLKEAEMEMKRTRSSPVQKSVYKLSLPRRCRSSSDQNFMRQELLK
EKKSELSRNNSLPLIDTAQAVDIHPVLHEEDQENTNKRNKSLLSNLKRKDLGESKSISRK
DYSHFDRIPSPSSARSVGETDFNYNREPSEDTLRYPDSIIEVTNRTSPAPNSILSRSGQF
VNSNDLSDGFSTSNTINNVGLNANEKIFFNALQSMEKENLMLWKTSQKYGTYLDERRKSA
DAFQKRERGSCVDIGKLHSSHLPFINILPPWPTELTEEERIIHDRLASKHSHHIRKHVHN
ARNKTSCKIKDSVGTFLGMTNSLTNKATVKKRTGQILKKEKMLVMVKEAIQNKVPLPNFS
ENECFDTRVSERWKEYIVIARSTGRFDPPILLQFYRHRHIPEIEDISSIATKYHRNPLDF
FLSRNCIVKFYSSLDKTISIQKPDKRLGGFIDESIEKKDELKHYSPIKIFILRCSSIRSS
GRWYKFLLESLDRQLFTPAINLKIPLTEISIKINLNEIIFQKLIDLGKQEKDRLKICFLQ
RGYKIFQHPILRYFTVAILEKLKLAHYDYLIRKWDTENPVLGCALKRYDRLEWIPCDEDS
LVTGIFAFCQSHLIQYRPIANRLRETKSLEGKCLKEPTPIEGFLIRLTDKYGSARTNFGK
YSISTAYFFTCENLLFSMKAYRANPPLPIDSMIDDTSTEIEKEEIWKQWKKIPEVYEQQP
YPLDANDHIEWMNCQTTQSEYDSRDFYAFHCFHRRIDQILKTDNVIDLTEVKDIYQGTRT
DYEADKIKYGVYKEASEIFWHRNYEIDDVSRSVINIETSNGLLLKLLATSATVAEEWVIK
LKQMISYWKNKQREDTERLLKIRRSNAGLLMLNGEEETKIGENTLRWIVEHGRADEQTFN
ANGISLSRPLIQKGPLYQKPHKHSVFSKYYVVLISGFIVLFHCFHRSTTGFAKEVLEYAH
YVTIPIDDCYLYSGTTTELDLLQRDRTFDEINYGSHALPRVYGDGWRSVEDESSRCFTLW
FGTRRALSSNRLQKKGNEKQYTQDYGRQDNNIDPPSAPEADLNNSNVPSNTDKIHFTKKL
GVSGKSMVFMARSRQERDLWVMSIYYELERLRRTASTSNSRNQTM
Download sequence
Identical sequences YDR104C YDR104C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]