SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YGR078C from Saccharomyces cerevisiae CLIB215

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGR078C
Domain Number 1 Region: 40-176
Classification Level Classification E-value
Superfamily Prefoldin 1.96e-18
Family Prefoldin 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YGR078C
Sequence length 199
Comment PAC10 ORF Verified Part of the heteromeric co-chaperone GimC/prefoldin complex, which promotes efficient protein folding
Sequence
MDTLFNSTEKNARGIPQAPFIENVNEIIKDPSDFELCFNKFQERLSKYKFMQESKLATIK
QLKTRIPDLENTLKICQSLRNHSDEGDESDEPILLHYQLNDTLYTKAQVDIPEDRADLKV
GLWLGADVMLEYPIDEAIELLKKKLADSEQSLTVSTEDVEFLRENITTMEVNCARLYNWD
VQRRQDLKQAQEGTKNLKI
Download sequence
Identical sequences A0A0L8VQF0 A0A250WCA1 A6ZV60 B3LIE8 C7GXQ7 C8Z8X2 E7KCW0 E7KNP8 E7Q420 G2WEG2 H0GGJ9 N1P270 P48363
4932.YGR078C YGR078C YGR078C YGR078C YGR078C SCRT_00939 YGR078C YGR078C 355025 YGR078C YGR078C YGR078C YGR078c___KOG3313 YGR078C YGR078C YGR078C tr|A6ZV60|A6ZV60_YEAS7 YGR078C YGR078C YGR078C YGR078C YGR078C YGR078C YGR078C YGR078C NP_011592.3.97178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]