SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YLR189C from Saccharomyces cerevisiae CLIB215

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLR189C
Domain Number 1 Region: 740-1161
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 7.85e-102
Family Gtf glycosyltransferase 0.0008
Further Details:      
 
Domain Number 2 Region: 232-360
Classification Level Classification E-value
Superfamily PH domain-like 3.56e-17
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YLR189C
Sequence length 1198
Comment ATG26 ORF Verified UDP-glucose:sterol glucosyltransferase, conserved enzyme involved in synthesis of sterol glucoside membrane lipids; in contrast to ATG26 from P. pastoris, S. cerevisiae ATG26 is not involved in autophagy
Sequence
MPITQIISASDSEAGPKPSISLVPDKPSEPETSPRHHRLSRSLSKFKRWRGRSNSSLSMG
SSEQQELQDSPNEARSDDDENGYNNDNADDLAKSKYMMKSIAGLLTTASVYAGMNNAQEM
NVLSQVDSEESDSSDSFQENIGRNEVKSKKENLKTKSHPEVPRLDKRKPTLFDFSITREK
LSKDNVAKLRQRFCLDEREPFLNDFPAWLLKDVLVQGHIFITTKHFLFFAYLPKNPRSVK
MSGNLNIRTKLIRSTRYWCVLKNHLFSMYTSSTELYFPVLTIDLREVQKIETQKHTLNGS
ATKTFKLYTDESTFKFNADSEFSAKSWVNALKKEQFAAQNSENNSISLKIPLPNIIEIDD
QPIVNKALTLRLRALESSQTYAIDDFMFVFMDGSGSQVKESLGEQLAILQKSGVNTLYYD
IPAKKSKSSFGKETPATAEQKNNGEDSKYLNVPTSAVPSSENGKKSRFRFRERSNSWFRR
AKPLEDSQVEDVEEIYKDAANDIDSSVHSTIHIHEQEDSQEQTVAWKPSHLKNFAEMWAA
KPIHYRNKFIPFQKDDTYLIKETEEVSANERFRYHFKFNKEKSLISTYYTYLNRNVPVYG
KIYVSNDTVCFRSLLPGSNTYMVLPLVDVETCYKEKGFRFGYFVLVIVIHGHEELFFEFS
TEVARDDIERILLKLLDNIYASSAEGSNISSASLGDVQHNPDSAKLKLFEDKINAEGFEV
PLMIDENPHYKTSIKPNKSYKFGLLTIGSRGDVQPYIALGKGLIKEGHQVVIITHSEFRD
FVESHGIQFEEIAGNPVELMSLMVENESMNVKMLREASSKFRGWIDALLQTSWEVCNRRK
FDILIESPSAMVGIHITEALQIPYFRAFTMPWTRTRAYPHAFIVPDQKRGGNYNYLTHVL
FENVFWKGISGQVNKWRVETLGLGKTNLFLLQQNNVPFLYNVSPTIFPPSIDFSEWVRVT
GYWFLDDKSTFKPPAELQEFISEARSKGKKLVYIGFGSIVVSNAKEMTEALVEAVMEADV
YCILNKGWSERLGDKAAKKTEVDLPRNILNIGNVPHDWLFPQVDAAVHHGGSGTTGASLR
AGLPTVIKPFFGDQFFYAGRVEDIGVGIALKKLNAQTLADALKVATTNKIMKDRAGLIKK
KISKEDGIKTAISAIYNELEYARSVTLSRVKTPRKKEENVDATKLTPAETTDEGWTMI
Download sequence
Identical sequences A0A0L8VLS4 B3RH80 B5VNA8 C7GIX6
YLR189C YLR189C YLR189C YLR189C YLR189C SCRT_04149

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]