SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YOL149W from Saccharomyces cerevisiae CLIB215

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOL149W
Domain Number 1 Region: 22-227
Classification Level Classification E-value
Superfamily PH domain-like 3.2e-76
Family Dcp1 0.00000000234
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YOL149W
Sequence length 231
Comment DCP1 ORF Verified Subunit of the Dcp1p-Dcp2p decapping enzyme complex, which removes the 5' cap structure from mRNAs prior to their degradation; enhances the activity of catalytic subunit Dcp2p; regulated by DEAD box protein Dhh1p
Sequence
MTGAATAAEKSATQLEFYRKALNFNVIGRYDPKIKQLLFHTPHASLYKWDFKKDEWNKLE
YQGVLAIYLRDVSQNTNLLPVSPQEVDIFDSQNGSNNIQVNNGSDNSNRNSSGNGNSYKS
NDSLTYNCGKTLSGKDIYNYGLIILNRINPDNFSMGIVPNSVVNKRKVFNAEEDTLNPLE
CMGVEVKDELVIIKNLKHEVYGIWIHTVSDRQNIYELIKYLLENEPKDSFA
Download sequence
Identical sequences YOL149W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]