SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YPL268W from Saccharomyces cerevisiae CLIB215

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YPL268W
Domain Number 1 Region: 384-718
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 4.71e-97
Family Mammalian PLC 0.0000117
Further Details:      
 
Domain Number 2 Region: 252-369
Classification Level Classification E-value
Superfamily EF-hand 1.55e-20
Family EF-hand modules in multidomain proteins 0.012
Further Details:      
 
Domain Number 3 Region: 734-867
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000000000524
Family PLC-like (P variant) 0.0021
Further Details:      
 
Domain Number 4 Region: 102-213
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000209
Family Pleckstrin-homology domain (PH domain) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YPL268W
Sequence length 869
Comment PLC1 ORF Verified Phospholipase C, hydrolyzes phosphatidylinositol 4,5-biphosphate (PIP2) to generate the signaling molecules inositol 1,4,5-triphosphate (IP3) and 1,2-diacylglycerol (DAG); involved in regulating many cellular processes
Sequence
MTESAIDDQRFNLTKELQRHSCRDQGKITQKDDALDFISYSSFQSSFNTDQKSANNGSTV
RRSIRSIFRRAAELPRVHMGPLTYSHGINELVNKKLRKDCDLSTLCRVLQRGIRMIRMTR
RRRKFYEFKLINNNGQIIWKDGSKYLELDSVKDIRIGDTASTYQEEVDPKRLRSDSKLWI
TIIYKVSNKLKALHVVALNELDFNTFLSCICGLVKLRRELMESILLPDNSQFARIHWQIT
VSEKEEDEKKDTLSFADVKKLCDKFHIYVSTGQLLEFFQLADINHNGLLNYFEFEKFIKI
LKNRKEVNMIWSKFTKPPHSHLSFENFFQFLITEQHEQVDRQTAWSYFIKYREPTQLTMG
QDGFTKFLKEQPYLVEVKEELYSKPLNHYFIASSHNTYLLGKQIAETPSVEGYIQVLQQG
CRCVEIDIWDGENGPVVCHGFLTSAIPLKTVIRVIKKYAFITSPYPLIISLEINCNKDNQ
KLASLIMREVLAEQLYFVGTRTDKLPSPRELKHKILLKSKKTSEATRGLSVNEPFPSSFS
SSYESANEQELRMKDDSTNSSSATNSSSMQRIKRIGLKKHADIINDVSNISGIHGIKFRN
FSLPESKTIAHCFSLNERKVEYMIKDKHLKLSLDKHNRRYLMRVYPHVLRYKSSNFNPIP
FWKAGVQMVATNWQTNDIGQQLNLAMFQILDHQPDGSFKSGYVLKPKKLLPVVTKAKMIP
LIYEHFENGSDPVTVKIRILSTQLLPRLNDTSPSRNNTNSFVKVEFHTDDEPTMPISIDK
GTRISATEASTKSSQGNGFNPIWDAEVSITLKDTDLTFIKFMVISEETQIASVCLKLNYL
RMGYRHIPLFNMEGEQYIFCTLFIHTQIL
Download sequence
Identical sequences YPL268W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]