SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YPR091C from Saccharomyces cerevisiae CLIB215

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YPR091C
Domain Number 1 Region: 125-192,238-271
Classification Level Classification E-value
Superfamily PH domain-like 0.00000603
Family Pleckstrin-homology domain (PH domain) 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YPR091C
Sequence length 770
Comment ORF Verified Putative protein of unknown function; may interact with ribosomes, based on co-purification experiments; green fluorescent protein (GFP)-fusion protein localizes to the endoplasmic reticulum; YPR091C is not an essential gene
Sequence
MASLKVFLAVYLLGGITFLPLVLFTLYKIHLLYSNLKSASKKELDHDTADEIDEKTRLLA
RDIDPEFKAGKLEEQLGVKVFNKGWITVTKQYYYHSSEVAVILKNSNNNKDSDTALQEQI
LQRTDLKKKQRFFAVLRHGNLFLYKDDSQNANLVHAISLQNRFITIWPRFDELGKEELPD
ASLFTKRTCIAIFKNDLVSIDSKNHNVILPHFDPLTSAESNNGDISTNDTTHEYQSQFHS
SNQFFLYFDNNMDKEDWYYQLINASKNSNSLSTGLLDPNVSANAAHLKTKDMLQLIQDIN
STENQLTTKWLNALLGRLFLSLQQTDTLNKFIHEKICKKLNKIKTPGFLDDLVVEKVDVG
DSAPLFTSPELLELSPEGSTKIAIDVQYRGNLTIIIATKASINLGSHFKQREVSLQLSIK
IKEFSGPLLFLIKPPPSNRIWYAFRTEPIMDFEIEPIVSSSKLSYNVVTNAIKSKFAEAV
KESLVVPFMDDIVFYPTPNEVYRGGIWEEQDPEAAARARTAAAASDMNNTSAKEHLEALQ
EGGMKTQSRIKKALRPERKKENLKDLVDASGVATKTTTQTTVTTATNDDVSSSENSTKSR
KYFKNSIKKIGRWYKDNVGNSSDTEDMDEIDVQDKKNDDSADERESDNPILTSNPKMISN
RRPVPRRPSQPLNTLSPKLEGRKEKDTENFPVPPSASNMNASKMFANKENRKFSVSSNDS
QNSLKNGDPHVKASKLESSQAFVKKTSQNRFNDGFFKQDLEFEEQREPKL
Download sequence
Identical sequences YPR091C YPR091C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]