SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YCR060W from Saccharomyces cerevisiae CLIB324

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YCR060W
Domain Number 1 Region: 10-66
Classification Level Classification E-value
Superfamily TPR-like 8.21e-17
Family SCOPe 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YCR060W
Sequence length 111
Comment TAH1 ORF Verified HSP90 cofactor; interacts with Hsp82p, Pih1p, Rvb1 and Rvb2, contains a single TPR domain with at least two TPR motifs
Sequence
MSQFEKQKEQGNSLFKQGLYREAVHCYDQLITAQPQNPVGYSNKAMALIKLGEYTQAIQM
CQQGLRYTSTAEHVAIRSKLQYRLELAQGAVGSVQIPVVEVDELPEGYDRS
Download sequence
Identical sequences A0A0L8VUI0 A6ZTN6 B3LUC0 C8Z4E9 E7KA60 E7Q1G2 P25638
YCR060W YCR060W YCR060W YCR060W YCR060W 000145937|e2l6jA1|109.4.1.114|A:1-111 YCR060W tr|A6ZTN6|A6ZTN6_YEAS7 YCR060W NP_009986.1.97178 YCR060W YCR060W YCR060W YCR060W 2l6j_A 4cgq_A APC7675 YCR060W SCRT_05453 YCR060W 4932.YCR060W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]