SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YDR002W from Saccharomyces cerevisiae CLIB324

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR002W
Domain Number 1 Region: 61-200
Classification Level Classification E-value
Superfamily PH domain-like 1.72e-50
Family Ran-binding domain 0.0000331
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YDR002W
Sequence length 201
Comment YRB1 ORF Verified Ran GTPase binding protein; involved in nuclear protein import and RNA export, ubiquitin-mediated protein degradation during the cell cycle; shuttles between the nucleus and cytoplasm; is essential; homolog of human RanBP1
Sequence
MSSEDKKPVVDKKEEAAPKPPSSAVFSMFGGKKAEKPETKKDEEDTKEETKKEGDDAPES
PDIHFEPVVHLEKVDVKTMEEDEEVLYKVRAKLFRFDADAKEWKERGTGDCKFLKNKKTN
KVRILMRRDKTLKICANHIIAPEYTLKPNVGSDRSWVYACTADIAEGEAEAFTFAIRFGS
KENADKFKEEFEKAQEINKKA
Download sequence
Identical sequences A0A250W947 A6ZXW7 B3LGQ7 B5VFR2 C7GXY9 E7KAP0 E7NGM6 E7Q210 E7QCN2 G2WCF5 N1P601 P41920
YDR002W YDR002W YDR002W YDR002W YDR002W tr|A6ZXW7|A6ZXW7_YEAS7 NP_010285.1.97178 YDR002W YDR002W YDR002W SCRT_00506 YDR002W YDR002W YDR002W YDR002W YDR002W YDR002W YDR002W NYSGXRC-P033 YDR002W YDR002W YDR002W YDR002W YDR002W 4932.YDR002W YDR002W YDR002W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]