SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for AE017220|CDS_2269627-2268875 from The Salmonella enterica Pan-genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AE017220|CDS_2269627-2268875
Domain Number 1 Region: 38-163
Classification Level Classification E-value
Superfamily PapD-like 5.76e-38
Family Pilus chaperone 0.00044
Further Details:      
 
Domain Number 2 Region: 159-248
Classification Level Classification E-value
Superfamily Periplasmic chaperone C-domain 0.0000000000000118
Family Periplasmic chaperone C-domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AE017220|CDS_2269627-2268875
Sequence length 250
Comment /sourcefile="Salmonella_annika.proteins.fsa.dir/9618.proteins.fsa" /gene_family="1680" /family_size="31" /organism="S. enterica Choleraesuis str. SC-B67"
Sequence
MLLTNLFNRRRSSPVFYKQGRVNMKILSAVLLSAIILPAHAGIVIYGTRVIYPAEKKEVV
VQLVNQGEQASLVQSWIDDGNTSLPPEKIQVPFMLTPPVARVAAESGQQLKIKKMPNSLP
DNKESLFYLNVLDIPPNSQENAGKNVLKFTMQNRIKLIWRPSRIAAVTKDSFQRIGLFRS
NKTVIMKNDTANWITVTDVKAGNTKINDQTIMLPPLSTQNINMKYASTSQYEVTIIDDNG
NYISSKINVK
Download sequence
Identical sequences Q57MI9
321314.SC2166 gi|62180736|ref|YP_217153.1| AE017220|CDS_2269627-2268875 WP_001540416.1.22270 WP_001540416.1.32493 WP_001540416.1.36948 WP_001540416.1.44943 WP_001540416.1.50777 WP_001540416.1.57902 WP_001540416.1.60486 WP_001540416.1.76162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]