SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AE017220|CDS_24972-25799 from The Salmonella enterica Pan-genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AE017220|CDS_24972-25799
Domain Number 1 Region: 75-193
Classification Level Classification E-value
Superfamily PapD-like 4.97e-39
Family Pilus chaperone 0.0000288
Further Details:      
 
Domain Number 2 Region: 187-269
Classification Level Classification E-value
Superfamily Periplasmic chaperone C-domain 9.94e-17
Family Periplasmic chaperone C-domain 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AE017220|CDS_24972-25799
Sequence length 275
Comment /sourcefile="Salmonella_annika.proteins.fsa.dir/9618.proteins.fsa" /gene_family="1974" /family_size="60" /organism="S. enterica Choleraesuis str. SC-B67"
Sequence
MLPRRRHLAWFIPDSLSGFFSRLLGGEKGALRASLRVTNRRHQDITQMKKNVPIFLRLLL
LLSAAGLSFAAQAGGIALGATRVIYPQGSKQTSLPIINSSASNVFLIQSWVANADGSRST
DFIITPPLFVIQPKKENILRIMYVGPSLPTDRESVFYLNSKAIPSVDKNKLTGNSLQIAT
QSVIKLFIRPKNLAEAPAHAPSTLRCRNERGQLTITNPSPYYVSMVELYSAGKKLPNTMV
PPKGAITLPATPGQVSLRTVNDFGATTPARVCPAS
Download sequence
Identical sequences A0A0F6AWE5 B5F700 Q57TN4
gi|563651627|ref|YP_008859680.1| ABFH02000001|CDS_268360-267533 AE017220|CDS_24972-25799 CP001138|CDS_24973-25800 CP001363|CDS_24971-25798 gi|62178591|ref|YP_215008.1| 321314.SC0021 454166.SeAg_B0025

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]