SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YBR213W from Saccharomyces cerevisiae FL100

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBR213W
Domain Number 1 Region: 145-272
Classification Level Classification E-value
Superfamily Siroheme synthase middle domains-like 2.22e-34
Family Siroheme synthase middle domains-like 0.000000416
Further Details:      
 
Domain Number 2 Region: 1-150
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 2.63e-22
Family Siroheme synthase N-terminal domain-like 0.0000000822
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YBR213W
Sequence length 274
Comment MET8 ORF Verified Bifunctional dehydrogenase and ferrochelatase, involved in the biosynthesis of siroheme, a prosthetic group used by sulfite reductase; required for sulfate assimilation and methionine biosynthesis
Sequence
MVKSLQLAHQLKDKKILLIGGGEVGLTRLYKLIPTGCKLTLVSPDLHKSIIPKFGKFIQN
EDQPDYREDAKRFINPNWDPTKNEIYEYIRSDFKDEYLDLEDENDAWYIIMTCIPDHPES
ARIYHLCKERFGKQQLVNVADKPDLCDFYFGANLEIGDRLQILISTNGLSPRFGALVRDE
IRNLFTQMGDLALEDAVVKLGELRRGIRLLAPDDKDVKYRMDWARRCTDLFGIQHCHNID
VKRLLDLFKVMFQEQNCSLQFPPRERLLSEYCSS
Download sequence
Identical sequences P15807
4932.YBR213W YBR213W YBR213w YT357 YBR213W NP_009772.1.97178 YBR213W YBR213W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]