SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YDR318W from Saccharomyces cerevisiae FL100

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YDR318W
Domain Number - Region: 114-160
Classification Level Classification E-value
Superfamily HAND domain of the nucleosome remodeling ATPase ISWI 0.0111
Family HAND domain of the nucleosome remodeling ATPase ISWI 0.014
Further Details:      
 
Domain Number - Region: 4-42
Classification Level Classification E-value
Superfamily Prefoldin 0.0837
Family Prefoldin 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YDR318W
Sequence length 368
Comment MCM21 ORF Verified Protein involved in minichromosome maintenance; component of the COMA complex (Ctf19p, Okp1p, Mcm21p, Ame1p) that bridges kinetochore subunits that are in contact with centromeric DNA and the subunits bound to microtubules
Sequence
MSRIDDLQQDIESLLSEINSLEESREKLKAKIKDKRKNEESANPIVQEFEDLFDQFPQLN
NFLFNEHPELEETDDKDISRAQADIPATPIPYEPKKRAKLENEEILPEQEWVLKTQPMVQ
HQMFDPGVADLLDTDILTSPSKRKRKLKIDDISTSDRSELEDYIVLENVYRMFGITFFPL
VDPIDLKIKDASGEIFVDREMLGIRLEVFSERTSQFEKPHYVLLKKRIKSNSWFLFKHTI
PSFIDVQGIFDDTNGGLVISHDDAYLFAKRVFLQLVEVQKRRQIFKDLEAKKIIHDLNLD
LESSMVSFFVKDIKVELFVKQNEIVSCSILDDIHDFSQNNKSKWEIALLGSLDDLELKLN
HSFATIFK
Download sequence
Identical sequences YDR318W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]