SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YFR041C from Saccharomyces cerevisiae FL100

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YFR041C
Domain Number 1 Region: 41-139
Classification Level Classification E-value
Superfamily Chaperone J-domain 1.44e-19
Family Chaperone J-domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YFR041C
Sequence length 295
Comment ERJ5 ORF Verified Type I membrane protein with a J domain is required to preserve the folding capacity of the endoplasmic reticulum; loss of the non-essential ERJ5 gene leads to a constitutively induced unfolded protein response
Sequence
MNGYWKPALVVLGLLSLSYAFTTIETEIFQLQNEISTKYGPDMNFYKFLKLPKLQNSSTK
EITKNLRKLSKKYHPDKNPKYRKLYERLNLATQILSNSSNRKIYDYYLQNGFPNYDFHKG
GFYFSRMKPKTWFLLAFIWIVVNIGQYIISIIQYRSQRSRIENFISQCKQQDDTNGLGVK
QLTFKQHEKDEGKSLVVRFSDVYVVEPDGSETLISPDTLDKPSVKNCLFWGIPASVWNMT
FDKSVGSAGKEEIITDSKKYDGNQSKKGNKVKKGSAKKGQKKMELPNGKVIYSRK
Download sequence
Identical sequences YFR041C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]