SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YGL121C from Saccharomyces cerevisiae FL100

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YGL121C
Domain Number - Region: 66-123
Classification Level Classification E-value
Superfamily TPR-like 0.014
Family BTAD-like 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YGL121C
Sequence length 126
Comment GPG1 ORF Verified Proposed gamma subunit of the heterotrimeric G protein that interacts with the receptor Gpr1p; involved in regulation of pseudohyphal growth; requires Gpb1p or Gpb2p to interact with Gpa2p; overproduction causes prion curing
Sequence
MFYLSDIEEEASAGAEPTYNFWEVLLFSNTQENLVTVVGELHTLTDRVVHYKIEPESREV
TATTLPSLLALLLEKRNQARRLYRDVLSMKMSELDWDIDDLFTQLQEELTRTDDTLSMYP
RRRFYH
Download sequence
Identical sequences A0A0L8VQX2 A0A250WBS7 A6ZU61 B3LHI1 C7GM14 C8Z8D0 E7KCF0 E7KND0 E7LUA1 E7NHK2 E7QEM4 G2WDY1 H0GFV5 N1P3G7 P53130
YGL121C YGL121C YGL121C YGL121C YGL121C YGL121C YGL121C YGL121C YGL121C YGL121C NP_011394.1.97178 YGL121C YGL121C YGL121C YGL121C YGL121C YGL121C 4932.YGL121C YGL121C YT446 YGL121C YGL121C YGL121C tr|A6ZU61|A6ZU61_YEAS7 SCRT_01116 YGL121C YGL121C YGL121C YGL121C YGL121C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]