SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YGL128C from Saccharomyces cerevisiae FL100

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGL128C
Domain Number 1 Region: 12-91
Classification Level Classification E-value
Superfamily Chaperone J-domain 3.93e-16
Family Chaperone J-domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YGL128C
Sequence length 283
Comment CWC23 ORF Verified Component of a complex containing Cef1p, putatively involved in pre-mRNA splicing; has similarity to E. coli DnaJ and other DnaJ-like proteins and to S. pombe Cwf23p
Sequence
MPGHELEDVINQRLNLYDVLELPTPLDVHTIYDDLPQIKRKYRSLALKYHPDKHPDNPSI
IHKFHLLSTATNILTNADVRPHYDRWLIEFLRKTNDIERNKLIQKLEESESSTIPTTTPH
PDLLQIQRHGELLRKLKHFNLPYGDWKHLNTQDQENASQHPYYDCSTLRIVLDNFLQSNN
KSNCLSHLRNQVFITLSANEIYDIYFSERNNYSKDDSIIIYTVFDTPITAQHVFRNWSSG
NLIPTVKDISPLIPLHYYSDFNLETELNDDIARLVSNEPILLD
Download sequence
Identical sequences YGL128C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]