SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YJL162C from Saccharomyces cerevisiae FL100

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YJL162C
Domain Number 1 Region: 7-77
Classification Level Classification E-value
Superfamily Chaperone J-domain 8.11e-19
Family Chaperone J-domain 0.00085
Further Details:      
 
Weak hits

Sequence:  YJL162C
Domain Number - Region: 240-256
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0628
Family beta-sandwich domain of Sec23/24 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YJL162C
Sequence length 393
Comment JJJ2 ORF Verified Protein of unknown function, contains a J-domain, which is a region with homology to the E. coli DnaJ protein
Sequence
MSQVIEPQLDRTTYYSILGLTSNATSSEVHKSYLKLARLLHPDKTKSDKSEELFKAVVHA
HSILTDEDQKLRYDRDLKIKGLHTYQPKKNCHIFKTKAKESQGASPTLGQSEAYHRQNKP
YEQQPYGFGVGKKMTSSSKSKVPIFKSFNLKSYQRNHYYSSKKERKHGSPDIDSLFHETN
GASKVRMTDAGKMDTNSQFQEIWEILGKNAYTHKSYSEDPNSCLGSALSDHEEEEEAGKQ
QQQQQQQQQQQQHYGMTSKSSSPDEEKKNNKEPKRESRVSPEENGEEETGHKQFKLPKTS
TFSSGSHDSNLQSPFYNHEYRHYARSKFECKNQFRKSVSPIKEIPATTSANEGWNILRDI
IEKLNISNVDDRNKDLLFRRDEIGDKNHSDSST
Download sequence
Identical sequences YJL162C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]