SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YLR008C from Saccharomyces cerevisiae FL100

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLR008C
Domain Number 1 Region: 102-163
Classification Level Classification E-value
Superfamily Chaperone J-domain 2.09e-16
Family Chaperone J-domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YLR008C
Sequence length 168
Comment PAM18 ORF Verified Constituent of the import motor (PAM complex) component of the Translocase of the Inner Mitochondrial membrane (TIM23 complex); essential J-protein cochaperone that stimulates Ssc1p ATPase activity to drive import; inhibited by Pam16p
Sequence
MSSQSNTGNSIEAPQLPIPGQTNGSANVTVDGAGVNVGIQNGSQGQKTGMDLYFDQALNY
MGEHPVITGFGAFLTLYFTAGAYKSISKGLNGGKSTTAFLKGGFDPKMNSKEALQILNLT
ENTLTKKKLKEVHRKIMLANHPDKGGSPFLATKINEAKDFLEKRGISK
Download sequence
Identical sequences A0A0L8VKD9 A7A0R3 B3LSY1 B5VMV0 C8ZCY0 E7KFN0 E7KRF7 E7LXA8 E7Q6R6 H0GJY4 N1P014 Q07914
YLR008C tr|A7A0R3|A7A0R3_YEAS7 4932.YLR008C YLR008C YLR008C APC89498 YT668 NP_013108.1.97178 YLR008C YLR008C YLR008C YLR008C YLR008C YLR008C YLR008C SCRT_04997 YLR008C YLR008C YLR008C YLR008C YLR008C YLR008C YLR008C YLR008C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]