SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YNL328C from Saccharomyces cerevisiae FL100

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YNL328C
Domain Number 1 Region: 75-140
Classification Level Classification E-value
Superfamily Chaperone J-domain 0.0000000000000301
Family Chaperone J-domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YNL328C
Sequence length 146
Comment MDJ2 ORF Verified Constituent of the mitochondrial import motor associated with the presequence translocase; function overlaps with that of Pam18p; stimulates the ATPase activity of Ssc1p to drive mitochondrial import; contains a J domain
Sequence
MVLPIIIGLGVTMVALSVKSGLNAWTVYKTLSPLTIAKLNNIRIENPTAGYRDALKFKSS
LIDEELKNRLNQYQGGFAPRMTEPEALLILDISAREINHLDEKLLKKKHRKAMVRNHPDR
GGSPYMAAKINEAKEVLERSVLLRKR
Download sequence
Identical sequences A0A250WGI8 N1P4X5 P42834
YNL328C YNL328C NP_014071.1.97178 XP_015331602.1.40921 YNL328C YNL328C YNL328C 4932.YNL328C YNL328C YNL328C YNL328C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]